PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT3G27810.1
Common NameATMYB21, ATMYB3, MGF10.23, MYB21
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 226aa    MW: 25351.1 Da    PI: 6.9604
Description myb domain protein 21
Gene Model
Gene Model ID Type Source Coding Sequence
AT3G27810.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.82.1e-172269148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT eEd++l+++++ +G g W++ a+  g++Rt+k+c++rw++yl
      AT3G27810.1 22 KGPWTMEEDLILINYIANHGDGVWNSLAKSAGLKRTGKSCRLRWLNYL 69
                     79********************************************97 PP

2Myb_DNA-binding543.9e-1775118146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T+eE++++ ++++++G++ W++Ia++++ gRt++++k++w++
      AT3G27810.1  75 RGNITPEEQLIIMELHAKWGNR-WSKIAKHLP-GRTDNEIKNFWRT 118
                      7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.9981769IPR017930Myb domain
SuperFamilySSF466897.49E-3020116IPR009057Homeodomain-like
SMARTSM007171.8E-122171IPR001005SANT/Myb domain
PfamPF002491.9E-162269IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.5E-232376IPR009057Homeodomain-like
CDDcd001672.34E-102469No hitNo description
PROSITE profilePS5129424.86570124IPR017930Myb domain
SMARTSM007175.0E-1574122IPR001005SANT/Myb domain
PfamPF002498.4E-1675118IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-2477123IPR009057Homeodomain-like
CDDcd001673.39E-1279118No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0009585Biological Processred, far-red light phototransduction
GO:0009740Biological Processgibberellic acid mediated signaling pathway
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0030154Biological Processcell differentiation
GO:0080086Biological Processstamen filament development
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000293anatomyguard cell
PO:0009009anatomyplant embryo
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009052anatomyflower pedicel
PO:0009062anatomygynoecium
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001185developmental stageplant embryo globular stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 226 aa     Download sequence    Send to blast
MEKRGGGSSG GSGSSAEAEV RKGPWTMEED LILINYIANH GDGVWNSLAK SAGLKRTGKS  60
CRLRWLNYLR PDVRRGNITP EEQLIIMELH AKWGNRWSKI AKHLPGRTDN EIKNFWRTRI  120
QKYIKQSDVT TTSSVGSHHS SEINDQAAST SSHNVFCTQD QAMETYSPTP TSYQHTNMEF  180
NYGNYSAAAV TATVDYPVPM TVDDQTGENY WGMDDIWSSM HLLNGN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C5e-261912424128MYB TRANSFORMING PROTEIN
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO306889340.0
Genevisible257220_at0.0
Expression AtlasAT3G27810-
AtGenExpressAT3G27810-
ATTED-IIAT3G27810-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Mainly expressed in floral tissues. expressed in all four whorls of the flower, in the anther vascular tissue and in cells at the junction between anther and stamen filaments. Detected in the nectaries and ovules. {ECO:0000269|PubMed:16805732, ECO:0000269|PubMed:19325888, ECO:0000269|Ref.1}.
Functional Description ? help Back to Top
Source Description
TAIREncodes a member of the R2R3-MYB transcription factor gene family. Induced by jasmonate. Involved in jasmonate response during stamen development.
UniProtTranscription factor involved in photomorphogenesis in the light. May act downstream of the light receptor network and directly affects transcription of light-induced genes. In darkness, its probable degradation prevent the activation of light-induced genes. Required to activate expression of PAL. Acts redundantly with MYB24 and MYB57 to control stamen filament elongation in the late developed flowers. Contributes with MYB24 to induction of MYB108 by jasmonate. Repressed at the transcript levels by DELLA proteins. {ECO:0000269|PubMed:11967090, ECO:0000269|PubMed:16805732, ECO:0000269|PubMed:19091873, ECO:0000269|PubMed:19325888, ECO:0000269|PubMed:21447791}.
Function -- GeneRIF ? help Back to Top
  1. ANAC019 and AtMYB3 specifically interact with the C-terminal region (640-967) of AtCPL1 containing two double-stranded RNA binding motifs.
    [PMID: 18541146]
  2. Excess expression of MYB21 results in retarded stamen development.
    [PMID: 21447791]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT3G27810.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated by jasmonate. {ECO:0000269|PubMed:16805732}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- ATRM (Manually Curated Target Genes) ? help Back to Top
Source Target Gene (A: Activate/R: Repress)
ATRM AT3G06490(A), AT3G22370(A)
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDGibberellin, jasmonic acid, Jasmonic acid
Interaction ? help Back to Top
Source Intact With
BioGRIDAT3G27810, AT4G17880, AT5G40350, AT5G46760, AT5G46830, AT1G32640
Phenotype -- Disruption Phenotype ? help Back to Top
Source Description
UniProtDISRUPTION PHENOTYPE: Short anther filaments, delayed anther dehiscence and greatly reduced male fertility. Myb21 and myb24 double mutant is more severely sterile than myb21 mutant and has petals that just grew out of the sepals but ended at a lower level than the stigma. Myb21 and myb57 double mutant has an intermediate sterility phenotype and petals that grew to a final height parallel to the pistil. Myb21, myb24 and myb57 triple mutant has a strongly reduced fertility and an arrested growth of the petals that never grew out of the sepals. {ECO:0000269|PubMed:16805732, ECO:0000269|PubMed:19325888}.
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT3G27810
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1184390.0AK118439.1 Arabidopsis thaliana At3g27810 mRNA for putative myb family transcription factor (Atmyb3), complete cds, clone: RAFL19-68-M03.
GenBankAY5195890.0AY519589.1 Arabidopsis thaliana MYB transcription factor (At3g27810) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_189418.21e-171transcription factor MYB21
SwissprotQ9LK951e-173MYB21_ARATH; Transcription factor MYB21
TrEMBLD7LPK41e-169D7LPK4_ARALL; ATMYB21
STRINGAT3G27810.11e-170(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Representative plantOGRP5171784
Publications ? help Back to Top
  1. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  2. Seki M, et al.
    Functional annotation of a full-length Arabidopsis cDNA collection.
    Science, 2002. 296(5565): p. 141-5
    [PMID:11910074]
  3. Shin B, et al.
    AtMYB21, a gene encoding a flower-specific transcription factor, is regulated by COP1.
    Plant J., 2002. 30(1): p. 23-32
    [PMID:11967090]
  4. Gong W, et al.
    Genome-wide ORFeome cloning and analysis of Arabidopsis transcription factor genes.
    Plant Physiol., 2004. 135(2): p. 773-82
    [PMID:15208423]
  5. Wang XJ,Cao XL,Hong Y
    Isolation and characterization of flower-specific transcripts in Acacia mangium.
    Tree Physiol., 2005. 25(2): p. 167-78
    [PMID:15574398]
  6. Li J, et al.
    Two groups of MYB transcription factors share a motif which enhances trans-activation activity.
    Biochem. Biophys. Res. Commun., 2006. 341(4): p. 1155-63
    [PMID:16460676]
  7. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  8. Mandaokar A, et al.
    Transcriptional regulators of stamen development in Arabidopsis identified by transcriptional profiling.
    Plant J., 2006. 46(6): p. 984-1008
    [PMID:16805732]
  9. Cao D,Cheng H,Wu W,Soo HM,Peng J
    Gibberellin mobilizes distinct DELLA-dependent transcriptomes to regulate seed germination and floral development in Arabidopsis.
    Plant Physiol., 2006. 142(2): p. 509-25
    [PMID:16920880]
  10. Manzano C,Abraham Z,L
    Identification of ubiquitinated proteins in Arabidopsis.
    Plant Mol. Biol., 2008. 68(1-2): p. 145-58
    [PMID:18535787]
  11. Bang WY,Kim SW,Jeong IS,Koiwa H,Bahk JD
    The C-terminal region (640-967) of Arabidopsis CPL1 interacts with the abiotic stress- and ABA-responsive transcription factors.
    Biochem. Biophys. Res. Commun., 2008. 372(4): p. 907-12
    [PMID:18541146]
  12. Colinas J,Schmidler SC,Bohrer G,Iordanov B,Benfey PN
    Intergenic and genic sequence lengths have opposite relationships with respect to gene expression.
    PLoS ONE, 2008. 3(11): p. e3670
    [PMID:18989364]
  13. Mandaokar A,Browse J
    MYB108 acts together with MYB24 to regulate jasmonate-mediated stamen maturation in Arabidopsis.
    Plant Physiol., 2009. 149(2): p. 851-62
    [PMID:19091873]
  14. Rowan DD, et al.
    Environmental regulation of leaf colour in red 35S:PAP1 Arabidopsis thaliana.
    New Phytol., 2009. 182(1): p. 102-15
    [PMID:19192188]
  15. Cheng H, et al.
    Gibberellin acts through jasmonate to control the expression of MYB21, MYB24, and MYB57 to promote stamen filament growth in Arabidopsis.
    PLoS Genet., 2009. 5(3): p. e1000440
    [PMID:19325888]
  16. Peng J
    Gibberellin and jasmonate crosstalk during stamen development.
    J Integr Plant Biol, 2009. 51(12): p. 1064-70
    [PMID:20021553]
  17. Song S, et al.
    The Jasmonate-ZIM domain proteins interact with the R2R3-MYB transcription factors MYB21 and MYB24 to affect Jasmonate-regulated stamen development in Arabidopsis.
    Plant Cell, 2011. 23(3): p. 1000-13
    [PMID:21447791]
  18. Reeves PH, et al.
    A regulatory network for coordinated flower maturation.
    PLoS Genet., 2012. 8(2): p. e1002506
    [PMID:22346763]
  19. Li Y, et al.
    A cotton gene encoding MYB-like transcription factor is specifically expressed in pollen and is involved in regulation of late anther/pollen development.
    Plant Cell Physiol., 2013. 54(6): p. 893-906
    [PMID:23447105]
  20. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]
  21. Qi T,Huang H,Song S,Xie D
    Regulation of Jasmonate-Mediated Stamen Development and Seed Production by a bHLH-MYB Complex in Arabidopsis.
    Plant Cell, 2015. 27(6): p. 1620-33
    [PMID:26002869]
  22. Kranz HD, et al.
    Towards functional characterisation of the members of the R2R3-MYB gene family from Arabidopsis thaliana.
    Plant J., 1998. 16(2): p. 263-76
    [PMID:9839469]